PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR03G29970.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 324aa    MW: 35724.7 Da    PI: 8.0321
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR03G29970.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.64.5e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+ +++q G+g +W + ++++g++R++k+c++rw++yl
  LPERR03G29970.1 14 KGPWSPEEDAKLKSYIEQNGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding38.72.3e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd +++ +    G++ W+ Ia+ ++ gRt++++k++w++
  LPERR03G29970.1  69 GGFSEEEDRIILSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.706962IPR017930Myb domain
SuperFamilySSF466892.08E-2611109IPR009057Homeodomain-like
SMARTSM007176.5E-121364IPR001005SANT/Myb domain
PfamPF002495.0E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-241569IPR009057Homeodomain-like
CDDcd001673.90E-91662No hitNo description
PROSITE profilePS5129422.33263117IPR017930Myb domain
SMARTSM007175.6E-1267115IPR001005SANT/Myb domain
PfamPF002494.1E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2370117IPR009057Homeodomain-like
CDDcd001672.58E-971113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0035987Biological Processendodermal cell differentiation
GO:0045597Biological Processpositive regulation of cell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000021Biological Processregulation of ion homeostasis
GO:2000067Biological Processregulation of root morphogenesis
GO:0048226Cellular ComponentCasparian strip
GO:0000975Molecular Functionregulatory region DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MGRAPCCDKA SVKKGPWSPE EDAKLKSYIE QNGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDRIIL SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLFGK  120
QSRKDQRQQQ QLARQAAAAG EGQIKQEASR DANEAHGLAA GANYSWHHHH HHHHAMAVPV  180
HPMSAPMVEA GRVANDVDES IRKLLFKLGG NPFAALPALP SIAPPPIYEE APSLVAPMAY  240
GMTPLDEGGM QCSSVLPVLE LDESFHFNQV KLDGLECFFG MGDQSMRWNE VSPLVCPSNA  300
VASSSQGMQQ YSCLVEEQAG LGMQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1120180.0AK112018.1 Oryza sativa Japonica Group cDNA clone:006-308-C02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628327.10.0PREDICTED: transcription factor RAX3
TrEMBLA0A0D9VZI60.0A0A0D9VZI6_9ORYZ; Uncharacterized protein
STRINGBGIOSGA009746-PA0.0(Oryza sativa Indica Group)
STRINGORGLA03G0327000.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.11e-81myb domain protein 36